Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G03260.1
Common NameHDG8, HDGL2-8, T17B22.5
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 699aa    MW: 78426.2 Da    PI: 6.3178
Description homeodomain GLABROUS 8
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G03260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
     Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 r+ +++t++q+++Le++F+++++p++++r +L ++l+L+ +q+k+WFqN+R++ k
                 555689**********************************************998 PP

        START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                  +a +a +el ++ laee++Wvks    +  + +e++ +     +            ++e ++a++vv  ++ +l + +ld   +W+e ++    ka t
                  7889999*****************65533334444444.....3334567888889********************999999.******99999**** PP

        START  82 levissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                  + v+ sg       ++lq+m  +l  lsplvp R+f++vR++++ ++g w+i+d  v+++++     + + + ++pSg+li+ +++ hskv w+ehv+
                  ******************************************************..55666653..46688899************************ PP

        START 172 lkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                  ++ +l  h ++r l++ g   gak+w  tl+r ce+
                  *****99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.3E-152185IPR001356Homeobox domain
PROSITE profilePS5007116.2612181IPR001356Homeobox domain
CDDcd000866.10E-172482No hitNo description
PfamPF000461.9E-162679IPR001356Homeobox domain
PROSITE profilePS5084841.192204438IPR002913START domain
CDDcd088755.18E-97208434No hitNo description
SuperFamilySSF559611.03E-25209436No hitNo description
SMARTSM002349.6E-22213435IPR002913START domain
PfamPF018521.9E-30214435IPR002913START domain
Gene3DG3DSA:3.30.530.206.2E-5253403IPR023393START-like domain
SuperFamilySSF559612.33E-11455664No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasAT3G03260-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the embryo at early stage and in the endosperm. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G03260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1178670.0AK117867.1 Arabidopsis thaliana At3g03260 mRNA for unknown protein, complete cds, clone: RAFL19-04-D14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186976.20.0homeobox-leucine zipper protein HDG8
SwissprotQ9M9P40.0HDG8_ARATH; Homeobox-leucine zipper protein HDG8
TrEMBLR0HRS60.0R0HRS6_9BRAS; Uncharacterized protein
STRINGAT3G03260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
  4. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
  5. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
  6. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
  7. Kawanabe T,Fujimoto R,Sasaki T,Taylor JM,Dennis ES
    A comparison of transcriptome and epigenetic status between closely related species in the genus Arabidopsis.
    Gene, 2012. 506(2): p. 301-9